PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.14G062100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 186aa    MW: 20570.1 Da    PI: 6.5003
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.14G062100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.53e-4510108199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l
  Manes.14G062100.1.p  10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRL 99 
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          ++el+++++
  Manes.14G062100.1.p 100 QKELDAANA 108
                          ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.8529110IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-4410107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP  60
HQREDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVQRLQ KELDAANADL IRYACNEIPT  120
ALPAPPGTSS FQHIGHRQRP GDQFNRRLGN EGSFYQSSGM ALPYNFPWID NPSEDINEGG  180
EEGNM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046209.11e-116PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_011046208.11e-116PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_002322187.21e-116hypothetical protein POPTR_0015s09370g
SwissprotQ9FML44e-74LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLB9IEW91e-116B9IEW9_POPTR; Uncharacterized protein
STRINGPOPTR_0015s09370.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-75LBD family protein